SKP1A polyclonal antibody (A01)
  • SKP1A polyclonal antibody (A01)

SKP1A polyclonal antibody (A01)

Ref: AB-H00006500-A01
SKP1A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant SKP1A.
Información adicional
Size 50 uL
Gene Name SKP1
Gene Alias EMC19|MGC34403|OCP-II|OCP2|SKP1A|TCEB1L|p19A
Gene Description S-phase kinase-associated protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MPSIKLQSFDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVGSTQFCL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SKP1A (AAH25673, 1 a.a. ~ 160 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6500

Enviar uma mensagem


SKP1A polyclonal antibody (A01)

SKP1A polyclonal antibody (A01)