SKIV2L polyclonal antibody (A01)
  • SKIV2L polyclonal antibody (A01)

SKIV2L polyclonal antibody (A01)

Ref: AB-H00006499-A01
SKIV2L polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SKIV2L.
Información adicional
Size 50 uL
Gene Name SKIV2L
Gene Alias 170A|DDX13|HLP|SKI2|SKI2W|SKIV2
Gene Description superkiller viralicidic activity 2-like (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DQLPNTLKQGIERVRAVAKRIGEVQVACGLNQTVEEFVGELNFGLVEVVYEWARGMPFSELAGLSGTPEGLVVRCIQRLAEMCRSLRGAARLVGEPVLGAKMETAATLL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SKIV2L (NP_008860, 1125 a.a. ~ 1233 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6499

Enviar uma mensagem


SKIV2L polyclonal antibody (A01)

SKIV2L polyclonal antibody (A01)