SIM2 polyclonal antibody (A01)
  • SIM2 polyclonal antibody (A01)

SIM2 polyclonal antibody (A01)

Ref: AB-H00006493-A01
SIM2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SIM2.
Información adicional
Size 50 uL
Gene Name SIM2
Gene Alias MGC119447|SIM|bHLHe15
Gene Description single-minded homolog 2 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq ESSDLLYTPSYSLPFSYHYGHFPLDSHVFSSKKPMLPAKFGQPQGSPCEVARFFLSTLPASGECQWHYANPLVPSSSSPAKNPPEPPANTARHSLVPSYE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SIM2 (NP_005060, 426 a.a. ~ 525 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6493

Enviar uma mensagem


SIM2 polyclonal antibody (A01)

SIM2 polyclonal antibody (A01)