SILV purified MaxPab rabbit polyclonal antibody (D01P)
  • SILV purified MaxPab rabbit polyclonal antibody (D01P)

SILV purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006490-D01P
SILV purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SILV protein.
Información adicional
Size 100 ug
Gene Name SILV
Gene Alias D12S53E|ME20|PMEL|PMEL17|SI|SIL|gp100
Gene Description silver homolog (mouse)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDLVLKRCLLHLAVIGALLAVGATKVPRNQDWLGVSRQLRTKAWNRQLYPEWTEAQRLDCWRGGQVSLKVSNDGPTLIGANASFSIALNFPGSQKVLPDGQVIWVNNTIINGSQVWGGQPVYPQETDDACIFPDGGPCPSGSWSQKRSFVYVWKTWGQYWQVLGGPVSGLSIGTGRAMLGTHTMEVTVYHRRGSRSYVPLAHSSSAFTITDQVPFSVSVSQLRALDGGNKHFLRNQPLTFALQLHDPSGYLAEAD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SILV (NP_008859.1, 1 a.a. ~ 661 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6490

Enviar uma mensagem


SILV purified MaxPab rabbit polyclonal antibody (D01P)

SILV purified MaxPab rabbit polyclonal antibody (D01P)