ST6GAL1 monoclonal antibody (M01), clone 2E12
  • ST6GAL1 monoclonal antibody (M01), clone 2E12

ST6GAL1 monoclonal antibody (M01), clone 2E12

Ref: AB-H00006480-M01
ST6GAL1 monoclonal antibody (M01), clone 2E12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ST6GAL1.
Información adicional
Size 100 ug
Gene Name ST6GAL1
Gene Alias CD75|MGC48859|SIAT1|ST6GalI|ST6N
Gene Description ST6 beta-galactosamide alpha-2,6-sialyltranferase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IP,ELISA
Immunogen Prot. Seq WNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ST6GAL1 (NP_775323, 96 a.a. ~ 195 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6480
Clone Number 2E12
Iso type IgG2a Kappa

Enviar uma mensagem


ST6GAL1 monoclonal antibody (M01), clone 2E12

ST6GAL1 monoclonal antibody (M01), clone 2E12