ST6GAL1 purified MaxPab rabbit polyclonal antibody (D01P)
  • ST6GAL1 purified MaxPab rabbit polyclonal antibody (D01P)

ST6GAL1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006480-D01P
ST6GAL1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ST6GAL1 protein.
Información adicional
Size 100 ug
Gene Name ST6GAL1
Gene Alias CD75|MGC48859|SIAT1|ST6GalI|ST6N
Gene Description ST6 beta-galactosamide alpha-2,6-sialyltranferase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ST6GAL1 (NP_775324.1, 1 a.a. ~ 175 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6480

Enviar uma mensagem


ST6GAL1 purified MaxPab rabbit polyclonal antibody (D01P)

ST6GAL1 purified MaxPab rabbit polyclonal antibody (D01P)