SI monoclonal antibody (M01), clone 1A8
  • SI monoclonal antibody (M01), clone 1A8

SI monoclonal antibody (M01), clone 1A8

Ref: AB-H00006476-M01
SI monoclonal antibody (M01), clone 1A8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SI.
Información adicional
Size 100 ug
Gene Name SI
Gene Alias MGC131621|MGC131622
Gene Description sucrase-isomaltase (alpha-glucosidase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq DGESIDTYERDLYLSVQFNLNQTTLTSTILKRGYINKSETRLGSLHVWGKGTTPVNAVTLTYNGNKNSLPFNEDTTNMILRIDLTTHNVTLEEPIEINW
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SI (NP_001032, 1728 a.a. ~ 1826 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6476
Clone Number 1A8
Iso type IgG2b Kappa

Enviar uma mensagem


SI monoclonal antibody (M01), clone 1A8

SI monoclonal antibody (M01), clone 1A8