SI polyclonal antibody (A01)
  • SI polyclonal antibody (A01)

SI polyclonal antibody (A01)

Ref: AB-H00006476-A01
SI polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SI.
Información adicional
Size 50 uL
Gene Name SI
Gene Alias MGC131621|MGC131622
Gene Description sucrase-isomaltase (alpha-glucosidase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DGESIDTYERDLYLSVQFNLNQTTLTSTILKRGYINKSETRLGSLHVWGKGTTPVNAVTLTYNGNKNSLPFNEDTTNMILRIDLTTHNVTLEEPIEINW
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SI (NP_001032, 1728 a.a. ~ 1826 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6476

Enviar uma mensagem


SI polyclonal antibody (A01)

SI polyclonal antibody (A01)