SHOX2 polyclonal antibody (A01)
  • SHOX2 polyclonal antibody (A01)

SHOX2 polyclonal antibody (A01)

Ref: AB-H00006474-A01
SHOX2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SHOX2.
Información adicional
Size 50 uL
Gene Name SHOX2
Gene Alias OG12|OG12X|OGI2X|SHOT
Gene Description short stature homeobox 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SPELKDRKDDAKGMEDEGQTKIKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQLHK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SHOX2 (NP_006875, 117 a.a. ~ 204 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6474

Enviar uma mensagem


SHOX2 polyclonal antibody (A01)

SHOX2 polyclonal antibody (A01)