SHMT2 purified MaxPab mouse polyclonal antibody (B01P)
  • SHMT2 purified MaxPab mouse polyclonal antibody (B01P)

SHMT2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00006472-B01P
SHMT2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SHMT2 protein.
Información adicional
Size 50 ug
Gene Name SHMT2
Gene Alias GLYA|SHMT
Gene Description serine hydroxymethyltransferase 2 (mitochondrial)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MLYFSLFWAARPLQRCGQLVRMAIRAQHSNAAQTQTGEANRGWTGQESLSDSDPEMWELLQREKDRQCRGLELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQRRALEAFDLDPAQWGVNVQPYSGSPANLAVYTALLQPHDRIMGLDLPDGGHLTHGYMSDVKRISATSIFFESMPYKLNPKTGLIDYNQLALTARLFRPRLIIAGTSAYARLIDYARMREVCDEVKAHLLADMAHI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SHMT2 (NP_005403.2, 1 a.a. ~ 504 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6472

Enviar uma mensagem


SHMT2 purified MaxPab mouse polyclonal antibody (B01P)

SHMT2 purified MaxPab mouse polyclonal antibody (B01P)