SCG5 monoclonal antibody (M02), clone 8G11
  • SCG5 monoclonal antibody (M02), clone 8G11

SCG5 monoclonal antibody (M02), clone 8G11

Ref: AB-H00006447-M02
SCG5 monoclonal antibody (M02), clone 8G11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SCG5.
Información adicional
Size 100 ug
Gene Name SCG5
Gene Alias 7B2|P7B2|SGNE1|SgV
Gene Description secretogranin V (7B2 protein)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq EYPAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPVGKTDDGCLENTPDTAEFSREFQLHQHLFDPEHDYPGL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SCG5 (NP_003011, 59 a.a. ~ 159 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6447
Clone Number 8G11
Iso type IgG2a Kappa

Enviar uma mensagem


SCG5 monoclonal antibody (M02), clone 8G11

SCG5 monoclonal antibody (M02), clone 8G11