SGK polyclonal antibody (A01)
  • SGK polyclonal antibody (A01)

SGK polyclonal antibody (A01)

Ref: AB-H00006446-A01
SGK polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant SGK.
Información adicional
Size 50 uL
Gene Name SGK1
Gene Alias SGK
Gene Description serum/glucocorticoid regulated kinase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMNANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEVFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNSTTS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SGK (AAH01263.1, 1 a.a. ~ 431 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6446

Enviar uma mensagem


SGK polyclonal antibody (A01)

SGK polyclonal antibody (A01)