SFRS10 monoclonal antibody (M01), clone 7A1
  • SFRS10 monoclonal antibody (M01), clone 7A1

SFRS10 monoclonal antibody (M01), clone 7A1

Ref: AB-H00006434-M01
SFRS10 monoclonal antibody (M01), clone 7A1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SFRS10.
Información adicional
Size 100 ug
Gene Name SFRS10
Gene Alias DKFZp686F18120|Htra2-beta|SRFS10|TRA2-BETA|TRA2B|TRAN2B
Gene Description splicing factor, arginine/serine-rich 10 (transformer 2 homolog, Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq LGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SFRS10 (NP_004584, 120 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6434
Clone Number 7A1
Iso type IgG1 Kappa

Enviar uma mensagem


SFRS10 monoclonal antibody (M01), clone 7A1

SFRS10 monoclonal antibody (M01), clone 7A1