SFRS4 polyclonal antibody (A01)
  • SFRS4 polyclonal antibody (A01)

SFRS4 polyclonal antibody (A01)

Ref: AB-H00006429-A01
SFRS4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SFRS4.
Información adicional
Size 50 uL
Gene Name SFRS4
Gene Alias SRP75
Gene Description splicing factor, arginine/serine-rich 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PPTRTEYRLIVENLSSRCSWQDLKDYMRQAGEVTYADAHKGRKNEGVIEFVSYSDMKRALEKLDGTEVNGRKIRLVE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SFRS4 (NP_005617, 98 a.a. ~ 174 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6429

Enviar uma mensagem


SFRS4 polyclonal antibody (A01)

SFRS4 polyclonal antibody (A01)