SFRS3 polyclonal antibody (A01)
  • SFRS3 polyclonal antibody (A01)

SFRS3 polyclonal antibody (A01)

Ref: AB-H00006428-A01
SFRS3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SFRS3.
Información adicional
Size 50 uL
Gene Name SFRS3
Gene Alias SRp20
Gene Description splicing factor, arginine/serine-rich 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SFRS3 (NP_003008, 1 a.a. ~ 85 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6428

Enviar uma mensagem


SFRS3 polyclonal antibody (A01)

SFRS3 polyclonal antibody (A01)