SFRS2 purified MaxPab mouse polyclonal antibody (B01P)
  • SFRS2 purified MaxPab mouse polyclonal antibody (B01P)

SFRS2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00006427-B01P
SFRS2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SFRS2 protein.
Información adicional
Size 50 ug
Gene Name SFRS2
Gene Alias PR264|SC-35|SC35|SFRS2A|SRp30b
Gene Description splicing factor, arginine/serine-rich 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGADPGVGAVPGLAADLATAARSLGPALVLDLGRPPSPDPHEGPSPSPRRSPDLVRGPGPGLGPGVLPQCPRGNPNPGRDRRVPPSLLKRKERCPLKKMLRSPV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SFRS2 (AAH66958, 1 a.a. ~ 179 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6427

Enviar uma mensagem


SFRS2 purified MaxPab mouse polyclonal antibody (B01P)

SFRS2 purified MaxPab mouse polyclonal antibody (B01P)