SFRS1 purified MaxPab mouse polyclonal antibody (B01P)
  • SFRS1 purified MaxPab mouse polyclonal antibody (B01P)

SFRS1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00006426-B01P
SFRS1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SFRS1 protein.
Información adicional
Size 50 ug
Gene Name SFRS1
Gene Alias ASF|MGC5228|SF2|SF2p33|SRp30a
Gene Description splicing factor, arginine/serine-rich 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SFRS1 (AAH10264, 1 a.a. ~ 248 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6426

Enviar uma mensagem


SFRS1 purified MaxPab mouse polyclonal antibody (B01P)

SFRS1 purified MaxPab mouse polyclonal antibody (B01P)