SFPQ monoclonal antibody (M01), clone 3B10
  • SFPQ monoclonal antibody (M01), clone 3B10

SFPQ monoclonal antibody (M01), clone 3B10

Ref: AB-H00006421-M01
SFPQ monoclonal antibody (M01), clone 3B10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SFPQ.
Información adicional
Size 100 ug
Gene Name SFPQ
Gene Alias POMP100|PSF
Gene Description splicing factor proline/glutamine-rich (polypyrimidine tract binding protein associated)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq EEKISDSEGFKANLSLLRRPGEKTYTQRCRLFVGNLPADITEDEFKRLFAKYGEPGEVFINKGKGFGFIKLESRALAEIAKAELDDTPMRGRQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SFPQ (NP_005057, 269 a.a. ~ 361 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6421
Clone Number 3B10
Iso type IgG2a Kappa

Enviar uma mensagem


SFPQ monoclonal antibody (M01), clone 3B10

SFPQ monoclonal antibody (M01), clone 3B10