SELL purified MaxPab mouse polyclonal antibody (B02P) View larger

Mouse polyclonal antibody raised against a full-length human SELL protein.

AB-H00006402-B02P

New product

SELL purified MaxPab mouse polyclonal antibody (B02P)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 50 ug
Gene Name SELL
Gene Alias CD62L|LAM-1|LAM1|LECAM1|LNHR|LSEL|LYAM1|Leu-8|Lyam-1|PLNHR|TQ1|hLHRc
Gene Description selectin L
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SELL (NP_000646.1, 1 a.a. ~ 372 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6402

More info

Mouse polyclonal antibody raised against a full-length human SELL protein.

Enviar uma mensagem

Mouse polyclonal antibody raised against a full-length human SELL protein.

Mouse polyclonal antibody raised against a full-length human SELL protein.