SECTM1 purified MaxPab mouse polyclonal antibody (B01P)
  • SECTM1 purified MaxPab mouse polyclonal antibody (B01P)

SECTM1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00006398-B01P
SECTM1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SECTM1 protein.
Información adicional
Size 50 ug
Gene Name SECTM1
Gene Alias K12
Gene Description secreted and transmembrane 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGFWPVPAVVTAVFILLVALVMFAWYRCRCSQQRREKKFFLLEPQMKFAALRAGAQQGLSRASAELWTPDSEPTPRPLALVFKPSPLGALELLSPQPLFPYAADP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SECTM1 (AAH17716, 29 a.a. ~ 248 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6398

Enviar uma mensagem


SECTM1 purified MaxPab mouse polyclonal antibody (B01P)

SECTM1 purified MaxPab mouse polyclonal antibody (B01P)