SDCBP polyclonal antibody (A01)
  • SDCBP polyclonal antibody (A01)

SDCBP polyclonal antibody (A01)

Ref: AB-H00006386-A01
SDCBP polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SDCBP.
Información adicional
Size 50 uL
Gene Name SDCBP
Gene Alias MDA-9|ST1|SYCL|TACIP18
Gene Description syndecan binding protein (syntenin)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGND
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SDCBP (NP_005616, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6386

Enviar uma mensagem


SDCBP polyclonal antibody (A01)

SDCBP polyclonal antibody (A01)