CX3CL1 monoclonal antibody (M01), clone 1D6
  • CX3CL1 monoclonal antibody (M01), clone 1D6

CX3CL1 monoclonal antibody (M01), clone 1D6

Ref: AB-H00006376-M01
CX3CL1 monoclonal antibody (M01), clone 1D6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CX3CL1.
Información adicional
Size 100 ug
Gene Name CX3CL1
Gene Alias ABCD-3|C3Xkine|CXC3|CXC3C|NTN|NTT|SCYD1|fractalkine|neurotactin
Gene Description chemokine (C-X3-C motif) ligand 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq HHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLEPEATGES
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CX3CL1 (AAH01163, 26 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6376
Clone Number 1D6
Iso type IgG1 Kappa

Enviar uma mensagem


CX3CL1 monoclonal antibody (M01), clone 1D6

CX3CL1 monoclonal antibody (M01), clone 1D6