CXCL5 purified MaxPab rabbit polyclonal antibody (D01P)
  • CXCL5 purified MaxPab rabbit polyclonal antibody (D01P)

CXCL5 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006374-D01P
CXCL5 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CXCL5 protein.
Información adicional
Size 100 ug
Gene Name CXCL5
Gene Alias ENA-78|SCYB5
Gene Description chemokine (C-X-C motif) ligand 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CXCL5 (NP_002985.1, 1 a.a. ~ 114 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6374

Enviar uma mensagem


CXCL5 purified MaxPab rabbit polyclonal antibody (D01P)

CXCL5 purified MaxPab rabbit polyclonal antibody (D01P)