CXCL6 polyclonal antibody (A01)
  • CXCL6 polyclonal antibody (A01)

CXCL6 polyclonal antibody (A01)

Ref: AB-H00006372-A01
CXCL6 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CXCL6.
Información adicional
Size 50 uL
Gene Name CXCL6
Gene Alias CKA-3|GCP-2|GCP2|SCYB6
Gene Description chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CXCL6 (AAH13744, 38 a.a. ~ 114 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6372

Enviar uma mensagem


CXCL6 polyclonal antibody (A01)

CXCL6 polyclonal antibody (A01)