SCT purified MaxPab rabbit polyclonal antibody (D01P)
  • SCT purified MaxPab rabbit polyclonal antibody (D01P)

SCT purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006343-D01P
SCT purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SCT protein.
Información adicional
Size 100 ug
Gene Name SCT
Gene Alias -
Gene Description secretin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MAPRPLLLLLLLLGGSAARPAPPRARRHSDGTFTSELSRLREGARLQRLLQGLVGKRSEQDAENSMAWTRLSAGLLCPSGSNMPILQAWMPLDGTWSPWLPPGPMVSEPAGAAAEGTLRPR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SCT (NP_068739.1, 1 a.a. ~ 121 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6343

Enviar uma mensagem


SCT purified MaxPab rabbit polyclonal antibody (D01P)

SCT purified MaxPab rabbit polyclonal antibody (D01P)