SCNN1G purified MaxPab rabbit polyclonal antibody (D01P)
  • SCNN1G purified MaxPab rabbit polyclonal antibody (D01P)

SCNN1G purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006340-D01P
SCNN1G purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SCNN1G protein.
Información adicional
Size 100 ug
Gene Name SCNN1G
Gene Alias ENaCg|ENaCgamma|PHA1|SCNEG
Gene Description sodium channel, nonvoltage-gated 1, gamma
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAPGEKIKAKIKKNLPVTGPQAPTIKELMRWYCLNTNTHGCRRIVVSRGRLRRLLWIGFTLTAVALILWQCALLVFSFYTVSVSIKVHFRKLDFPAVTICNINPYKYSTVRHLLADLEQETREALKSLYGFPESRKRREAESWNSVSEGKQPRFSHRIPLLIFDQDEKGKARDFFTGRKRKVGGSIIHKASNVMHIESKQVVGFQLCSNDTSDCATYTFSSGINAIQEWYKLHYMNIMAQVPLEKKINMSYSAEE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SCNN1G (NP_001030.2, 1 a.a. ~ 649 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6340

Enviar uma mensagem


SCNN1G purified MaxPab rabbit polyclonal antibody (D01P)

SCNN1G purified MaxPab rabbit polyclonal antibody (D01P)