SCNN1B purified MaxPab mouse polyclonal antibody (B01P)
  • SCNN1B purified MaxPab mouse polyclonal antibody (B01P)

SCNN1B purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00006338-B01P
SCNN1B purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SCNN1B protein.
Información adicional
Size 50 ug
Gene Name SCNN1B
Gene Alias ENaCb|ENaCbeta|SCNEB
Gene Description sodium channel, nonvoltage-gated 1, beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MHVKKYLLKGLHRLQKGPGYTYKELLVWYCDNTNTHGPKRTICEGPKKKAMWFLLTLLFAALVCWQWGIFIRTYLSWEVSVSLSVGFKTMDFPAVTICNASPFKYSKIKHLLKDLDELMEAVLERILAPELSHANATRNLNFSIWNHTPLVLIDERNPHHPMVLDLFGDNHNGLTSSSASEKICNAHGCKMAMRLCSLNRTQCTFRNFTSATQALTEWYILQATNIFAQVPQQELVEMSYPGEQMILACLFGAEP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SCNN1B (AAH36352.2, 1 a.a. ~ 640 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6338

Enviar uma mensagem


SCNN1B purified MaxPab mouse polyclonal antibody (B01P)

SCNN1B purified MaxPab mouse polyclonal antibody (B01P)