SCN9A monoclonal antibody (M01), clone 5A11
  • SCN9A monoclonal antibody (M01), clone 5A11

SCN9A monoclonal antibody (M01), clone 5A11

Ref: AB-H00006335-M01
SCN9A monoclonal antibody (M01), clone 5A11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SCN9A.
Información adicional
Size 100 ug
Gene Name SCN9A
Gene Alias ETHA|NE-NA|NENA|Nav1.7|PN1
Gene Description sodium channel, voltage-gated, type IX, alpha subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,ELISA
Immunogen Prot. Seq GNLKHKCFRNSLENNETLESIMNTLESEEDFRKYFYYLEGSKDALLCGFSTDSGQCPEGYTCVKIGRNPDY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SCN9A (NP_002968, 269 a.a. ~ 339 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6335
Clone Number 5A11
Iso type IgG2b Kappa

Enviar uma mensagem


SCN9A monoclonal antibody (M01), clone 5A11

SCN9A monoclonal antibody (M01), clone 5A11