SCN8A monoclonal antibody (M04), clone 4G7
  • SCN8A monoclonal antibody (M04), clone 4G7

SCN8A monoclonal antibody (M04), clone 4G7

Ref: AB-H00006334-M04
SCN8A monoclonal antibody (M04), clone 4G7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SCN8A.
Información adicional
Size 100 ug
Gene Name SCN8A
Gene Alias CerIII|MED|NaCh6|Nav1.6|PN4
Gene Description sodium channel, voltage gated, type VIII, alpha subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq RVLGDSGELDILRQQMEERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYRGHLARRGFICKKTTSNKLENGGTHREKKESTPSTASLPSYDSVT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SCN8A (NP_055006, 1854 a.a. ~ 1951 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6334
Clone Number 4G7
Iso type IgG2a Kappa

Enviar uma mensagem


SCN8A monoclonal antibody (M04), clone 4G7

SCN8A monoclonal antibody (M04), clone 4G7