SCML1 monoclonal antibody (M01), clone 4G3
  • SCML1 monoclonal antibody (M01), clone 4G3

SCML1 monoclonal antibody (M01), clone 4G3

Ref: AB-H00006322-M01
SCML1 monoclonal antibody (M01), clone 4G3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SCML1.
Información adicional
Size 100 ug
Gene Name SCML1
Gene Alias -
Gene Description sex comb on midleg-like 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq KNEVYETFSYPESYSPTLPVSRRENNSPSNLPRPSFCMEEYQRAELEEDPILSRTPSPVHPSDFSEHNCQPYYASDGATYGSSSGLCLGNPRADSIHN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SCML1 (NP_006737, 3 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6322
Clone Number 4G3
Iso type IgG2a Kappa

Enviar uma mensagem


SCML1 monoclonal antibody (M01), clone 4G3

SCML1 monoclonal antibody (M01), clone 4G3