SCML1 MaxPab rabbit polyclonal antibody (D01)
  • SCML1 MaxPab rabbit polyclonal antibody (D01)

SCML1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00006322-D01
SCML1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SCML1 protein.
Información adicional
Size 100 uL
Gene Name SCML1
Gene Alias -
Gene Description sex comb on midleg-like 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP,IF
Immunogen Prot. Seq MKKNEVYETFSYPESYSPTLPVSRRENNSPSNLPRPSFCMEEYQRAELEEDPILSRTPSPVHPSDFSEHNCQPYYASDGATYGSSSGLCLGNPRADSIHNTYSTDHASAAPPSVTRSPVENDGYIEEGSITKHPSTWSVEAVVLFLKQTDPLALCPLVDLFRSHEIDGKALLLLTSDVLLKHLGVKLGTAVKLCYYIDRLKQGKCFEN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SCML1 (NP_001032624.1, 1 a.a. ~ 208 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 6322

Enviar uma mensagem


SCML1 MaxPab rabbit polyclonal antibody (D01)

SCML1 MaxPab rabbit polyclonal antibody (D01)