SCD monoclonal antibody (M02), clone 1B7
  • SCD monoclonal antibody (M02), clone 1B7

SCD monoclonal antibody (M02), clone 1B7

Ref: AB-H00006319-M02
SCD monoclonal antibody (M02), clone 1B7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SCD.
Información adicional
Size 50 ug
Gene Name SCD
Gene Alias FADS5|MSTP008|SCD1
Gene Description stearoyl-CoA desaturase (delta-9-desaturase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MPAHLLQDDISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYKDKEGPSPKVEYVWRNIILMSLLHLGALYGITLIPTCKFYT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SCD (NP_005054.3, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6319
Clone Number 1B7
Iso type IgG2a Kappa

Enviar uma mensagem


SCD monoclonal antibody (M02), clone 1B7

SCD monoclonal antibody (M02), clone 1B7