SALL2 purified MaxPab rabbit polyclonal antibody (D01P)
  • SALL2 purified MaxPab rabbit polyclonal antibody (D01P)

SALL2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006297-D01P
SALL2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SALL2 protein.
Información adicional
Size 100 ug
Gene Name SALL2
Gene Alias FLJ10414|FLJ55746|HSAL2|KIAA0360|ZNF795|p150(Sal2)
Gene Description sal-like 2 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAHESERSSRLGVPCGEPAELGGDASEEDHPQVCAKCCAQFTDPTEFLAHQNACSTDPPVMVIIGGQENPNNSSASSEPRPEGHNNPQVMDTEHSNPPDSGSSVPTDPTWGPERRGEESPGHFLVAATEPVCGIPVKWPAHEALEFQLHLHYHSKPGPTSAVWPRNCGWEGASNNGIQGSQGEDSPPPISASCTQGSA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SALL2 (ENSP00000320536, 1 a.a. ~ 198 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6297

Enviar uma mensagem


SALL2 purified MaxPab rabbit polyclonal antibody (D01P)

SALL2 purified MaxPab rabbit polyclonal antibody (D01P)