SAG purified MaxPab mouse polyclonal antibody (B01P)
  • SAG purified MaxPab mouse polyclonal antibody (B01P)

SAG purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00006295-B01P
SAG purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SAG protein.
Información adicional
Size 50 ug
Gene Name SAG
Gene Alias DKFZp686D1084|DKFZp686I1383|S-AG
Gene Description S-antigen
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAASGKTSKSEPNHVIFKKISRDKSVTIYLGNRDYIDHVSQVQPVDGVVLVDPDLVKGKKVYVTLTCAFRYGQEDIDVIGLTFRRDLYFSRVQVYPPVGAASTPTKLQESLLKKLGSNTYPFLLTFPDYLPCSVMLQPAPQDSGKSCGVDFEVKAFATDSTDAEEDKIPKKSSVRLLIRKVQHAPLEMGPQPRAEAAWQFFMSDKPLHLAVSLNKEIYFHGEPIPVTVTVTNNTEKTVKKIKAFVEQVANVVLYS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SAG (AAI56657.1, 1 a.a. ~ 405 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6295

Enviar uma mensagem


SAG purified MaxPab mouse polyclonal antibody (B01P)

SAG purified MaxPab mouse polyclonal antibody (B01P)