SAA4 monoclonal antibody (M08), clone 3C11
  • SAA4 monoclonal antibody (M08), clone 3C11

SAA4 monoclonal antibody (M08), clone 3C11

Ref: AB-H00006291-M08
SAA4 monoclonal antibody (M08), clone 3C11

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant SAA4.
Información adicional
Size 100 ug
Gene Name SAA4
Gene Alias C-SAA|CSAA
Gene Description serum amyloid A4, constitutive
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IP,ELISA
Immunogen Prot. Seq MRLFTGIVFCSLVMGVTSESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGVWAAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SAA4 (AAH07026, 1 a.a. ~ 130 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6291
Clone Number 3C11
Iso type IgG2a Kappa

Enviar uma mensagem


SAA4 monoclonal antibody (M08), clone 3C11

SAA4 monoclonal antibody (M08), clone 3C11