SAA1 polyclonal antibody (A01)
  • SAA1 polyclonal antibody (A01)

SAA1 polyclonal antibody (A01)

Ref: AB-H00006288-A01
SAA1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant SAA1.
Información adicional
Size 50 uL
Gene Name SAA1
Gene Alias MGC111216|PIG4|SAA|TP53I4
Gene Description serum amyloid A1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAADEWGRSGKDPNHFRPAGLPEKY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SAA1 (AAH07022, 1 a.a. ~ 122 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6288

Enviar uma mensagem


SAA1 polyclonal antibody (A01)

SAA1 polyclonal antibody (A01)