S100P monoclonal antibody (M02), clone 4E7
  • S100P monoclonal antibody (M02), clone 4E7

S100P monoclonal antibody (M02), clone 4E7

Ref: AB-H00006286-M02
S100P monoclonal antibody (M02), clone 4E7

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant S100P.
Información adicional
Size 100 ug
Gene Name S100P
Gene Alias MIG9
Gene Description S100 calcium binding protein P
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen S100P (AAH06819, 1 a.a. ~ 95 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6286
Clone Number 4E7
Iso type IgG2b Kappa

Enviar uma mensagem


S100P monoclonal antibody (M02), clone 4E7

S100P monoclonal antibody (M02), clone 4E7