S100A10 polyclonal antibody (A01)
  • S100A10 polyclonal antibody (A01)

S100A10 polyclonal antibody (A01)

Ref: AB-H00006281-A01
S100A10 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant S100A10.
Información adicional
Size 50 uL
Gene Name S100A10
Gene Alias 42C|ANX2L|ANX2LG|CAL1L|CLP11|Ca[1]|GP11|MGC111133|P11|p10
Gene Description S100 calcium binding protein A10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen S100A10 (AAH15973, 1 a.a. ~ 97 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6281

Enviar uma mensagem


S100A10 polyclonal antibody (A01)

S100A10 polyclonal antibody (A01)