S100A7 monoclonal antibody (M02), clone 1A4
  • S100A7 monoclonal antibody (M02), clone 1A4

S100A7 monoclonal antibody (M02), clone 1A4

Ref: AB-H00006278-M02
S100A7 monoclonal antibody (M02), clone 1A4

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant S100A7.
Información adicional
Size 50 ug
Gene Name S100A7
Gene Alias PSOR1|S100A7c
Gene Description S100 calcium binding protein A7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen S100A7 (AAH34687.1, 1 a.a. ~ 101 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6278
Clone Number 1A4
Iso type IgG1 Kappa

Enviar uma mensagem


S100A7 monoclonal antibody (M02), clone 1A4

S100A7 monoclonal antibody (M02), clone 1A4