S100A7 monoclonal antibody (M01), clone 1C5-C6
  • S100A7 monoclonal antibody (M01), clone 1C5-C6

S100A7 monoclonal antibody (M01), clone 1C5-C6

Ref: AB-H00006278-M01
S100A7 monoclonal antibody (M01), clone 1C5-C6

Información del producto

Mouse monoclonal antibody raised against a full length recombinant S100A7.
Información adicional
Size 100 ug
Gene Name S100A7
Gene Alias PSOR1|S100A7c
Gene Description S100 calcium binding protein A7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen S100A7 (AAH34687.1, 1 a.a. ~ 101 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6278
Clone Number 1C5-C6
Iso type IgG2b kappa

Enviar uma mensagem


S100A7 monoclonal antibody (M01), clone 1C5-C6

S100A7 monoclonal antibody (M01), clone 1C5-C6