S100A7 purified MaxPab rabbit polyclonal antibody (D03P)
  • S100A7 purified MaxPab rabbit polyclonal antibody (D03P)

S100A7 purified MaxPab rabbit polyclonal antibody (D03P)

Ref: AB-H00006278-D03P
S100A7 purified MaxPab rabbit polyclonal antibody (D03P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human S100A7 protein.
Información adicional
Size 100 ug
Gene Name S100A7
Gene Alias PSOR1|S100A7c
Gene Description S100 calcium binding protein A7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen S100A7 (AAH34687.1, 1 a.a. ~ 101 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6278

Enviar uma mensagem


S100A7 purified MaxPab rabbit polyclonal antibody (D03P)

S100A7 purified MaxPab rabbit polyclonal antibody (D03P)