S100A6 monoclonal antibody (M10), clone 6B5
  • S100A6 monoclonal antibody (M10), clone 6B5

S100A6 monoclonal antibody (M10), clone 6B5

Ref: AB-H00006277-M10
S100A6 monoclonal antibody (M10), clone 6B5

Información del producto

Mouse monoclonal antibody raised against a full length recombinant S100A6.
Información adicional
Size 100 ug
Gene Name S100A6
Gene Alias 2A9|5B10|CABP|CACY|PRA
Gene Description S100 calcium binding protein A6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq MACPLDRAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen S100A6 (AAH01431, 1 a.a. ~ 90 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6277
Clone Number 6B5
Iso type IgG1 Kappa

Enviar uma mensagem


S100A6 monoclonal antibody (M10), clone 6B5

S100A6 monoclonal antibody (M10), clone 6B5