S100A6 polyclonal antibody (A01)
  • S100A6 polyclonal antibody (A01)

S100A6 polyclonal antibody (A01)

Ref: AB-H00006277-A01
S100A6 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant S100A6.
Información adicional
Size 50 uL
Gene Name S100A6
Gene Alias 2A9|5B10|CABP|CACY|PRA
Gene Description S100 calcium binding protein A6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYSEALKG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen S100A6 (NP_055439, 18 a.a. ~ 90 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6277

Enviar uma mensagem


S100A6 polyclonal antibody (A01)

S100A6 polyclonal antibody (A01)