S100A4 polyclonal antibody (A01)
  • S100A4 polyclonal antibody (A01)

S100A4 polyclonal antibody (A01)

Ref: AB-H00006275-A01
S100A4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant S100A4.
Información adicional
Size 50 uL
Gene Name S100A4
Gene Alias 18A2|42A|CAPL|FSP1|MTS1|P9KA|PEL98
Gene Description S100 calcium binding protein A4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCDEFFEGFPDKQPRKK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen S100A4 (AAH16300, 1 a.a. ~ 101 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6275

Enviar uma mensagem


S100A4 polyclonal antibody (A01)

S100A4 polyclonal antibody (A01)