SORT1 monoclonal antibody (M01), clone 1B3
  • SORT1 monoclonal antibody (M01), clone 1B3

SORT1 monoclonal antibody (M01), clone 1B3

Ref: AB-H00006272-M01
SORT1 monoclonal antibody (M01), clone 1B3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SORT1.
Información adicional
Size 100 ug
Gene Name SORT1
Gene Alias Gp95|NT3
Gene Description sortilin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq FAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SORT1 (NP_002950, 203 a.a. ~ 299 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6272
Clone Number 1B3
Iso type IgG2a Kappa

Enviar uma mensagem


SORT1 monoclonal antibody (M01), clone 1B3

SORT1 monoclonal antibody (M01), clone 1B3