SORT1 polyclonal antibody (A01)
  • SORT1 polyclonal antibody (A01)

SORT1 polyclonal antibody (A01)

Ref: AB-H00006272-A01
SORT1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SORT1.
Información adicional
Size 50 uL
Gene Name SORT1
Gene Alias Gp95|NT3
Gene Description sortilin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq FAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SORT1 (NP_002950, 203 a.a. ~ 299 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6272

Enviar uma mensagem


SORT1 polyclonal antibody (A01)

SORT1 polyclonal antibody (A01)