RYK purified MaxPab mouse polyclonal antibody (B01P)
  • RYK purified MaxPab mouse polyclonal antibody (B01P)

RYK purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00006259-B01P
RYK purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RYK protein.
Información adicional
Size 50 ug
Gene Name RYK
Gene Alias D3S3195|JTK5|JTK5A|RYK1
Gene Description RYK receptor-like tyrosine kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRGAARLGRPGRSCLPGARGLRAPPPPPLLLLLALLPLLPAPGAAAAPAPRPPELQSASAGPSVSLYLSEDEVRRLIGLDAELYYVRNDLISHYALSFSLLVPSETNFLHFTWHAKSKVEYKLGFQVDNVLAMDMPQVNISVQGEVPRTLSVFRVELSCTGKVDSEVMILMQLNLTVNSSKNFTVLNFKRRKMCYKKLEEVKTSALDKNTSRTIYDPVHAAPTTSTRVFYISVGVCCAVIFLVAIILAVLHLHSM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RYK (AAI53091.1, 1 a.a. ~ 610 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6259

Enviar uma mensagem


RYK purified MaxPab mouse polyclonal antibody (B01P)

RYK purified MaxPab mouse polyclonal antibody (B01P)