RYK polyclonal antibody (A01)
  • RYK polyclonal antibody (A01)

RYK polyclonal antibody (A01)

Ref: AB-H00006259-A01
RYK polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RYK.
Información adicional
Size 50 uL
Gene Name RYK
Gene Alias D3S3195|JTK5|JTK5A|RYK1
Gene Description RYK receptor-like tyrosine kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq ELQSASAGPSVSLYLSEDEVRRLIGLDAELYYVRNDLISHYALSFNLLVPSETNFLHFTWHAKSKVEYKLGFQVDNVLAMDMPQVNISVQGEVPRTLSVFRVELSCTGKV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RYK (NP_002949, 54 a.a. ~ 163 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6259

Enviar uma mensagem


RYK polyclonal antibody (A01)

RYK polyclonal antibody (A01)