RXRB monoclonal antibody (M12), clone 1H1
  • RXRB monoclonal antibody (M12), clone 1H1

RXRB monoclonal antibody (M12), clone 1H1

Ref: AB-H00006257-M12
RXRB monoclonal antibody (M12), clone 1H1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RXRB.
Información adicional
Size 100 ug
Gene Name RXRB
Gene Alias DAUDI6|H-2RIIBP|MGC1831|NR2B2|RCoR-1
Gene Description retinoid X receptor, beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq QINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYSCRDNKDCTVDKRQRNRCQYC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RXRB (AAH01167.1, 161 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6257
Clone Number 1H1
Iso type IgG2b Kappa

Enviar uma mensagem


RXRB monoclonal antibody (M12), clone 1H1

RXRB monoclonal antibody (M12), clone 1H1