RSU1 polyclonal antibody (A01)
  • RSU1 polyclonal antibody (A01)

RSU1 polyclonal antibody (A01)

Ref: AB-H00006251-A01
RSU1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant RSU1.
Información adicional
Size 50 uL
Gene Name RSU1
Gene Alias FLJ31034|RSP-1
Gene Description Ras suppressor protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MSKSLKKLVEESREKNQPEVDMSDRGISNMLDVNGLFTLSHITQLVLSHNKLTMVPPNIAELKNLEVLNFFNNQIEELPTQISSLQKLKHLNLGMNRLNTLPRGFGSLPALEVLDLTYNNLSENSLPGNFFYLTTLRALYLSDNDFEILPPDIGKLTKLQILSLRDNDLISLPKEIGELTQLKELHIQGNRLTVLPPELGNLDLTGQKQVFKAENNPWVTPIADQFQLGVSHVFEYIRSETYKYLYGRHMQANPE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RSU1 (AAH05993, 1 a.a. ~ 277 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6251

Enviar uma mensagem


RSU1 polyclonal antibody (A01)

RSU1 polyclonal antibody (A01)